PDB entry 3dbv

View 3dbv on RCSB PDB site
Description:
Deposited on 1997-01-06, released 1997-07-07
The last revision prior to the SCOP 1.65 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.196
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d3dbvo1, d3dbvo2
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d3dbvp1, d3dbvp2
  • Chain 'Q':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d3dbvq1, d3dbvq2
  • Chain 'R':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d3dbvr1, d3dbvr2

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dbvO (O:)
    avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dbvP (P:)
    avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dbvQ (Q:)
    avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dbvR (R:)
    avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl