PDB entry 3dbs

View 3dbs on RCSB PDB site
Description: Structure of PI3K gamma in complex with GDC0941
Class: transferase
Keywords: PI3K gamma, Inhibitor, Kinase, Transferase
Deposited on 2008-06-02, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3dbsa1, d3dbsa2, d3dbsa3, d3dbsa4, d3dbsa5
  • Heterogens: GD9

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dbsA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dbsA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmaeqdfvlrvc
    grdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgid
    ipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgall
    nlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsisill
    dnhpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvk
    wgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvl
    hyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavil
    eaylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqns
    qlpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgdd
    lrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvg
    ntgafkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitet
    gnlfhidfghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliil
    fsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhl
    v