PDB entry 3d8c

View 3d8c on RCSB PDB site
Description: Factor inhibiting HIF-1 alpha D201G mutant in complex with ZN(II), alpha-ketoglutarate and HIF-1 alpha 19mer
Class: transcription regulator, oxidoreductase
Keywords: FIH, HIF, DSBH, OXYGENASE, TRANSCRIPTION, HYPOXIA, INHIBITOR 2-OXOGLUTARATE, ASPARAGINYL HYDROXYLASE, TRANSCRIPTION REGULATOR, OXIDOREDUCTASE, Dioxygenase, Iron, Metal-binding, Nucleus, Transcription regulation
Deposited on 2008-05-23, released 2008-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxia-inducible factor 1 alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: HIF1AN, FIH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWT6 (10-348)
      • expression tag (8-9)
      • engineered (200)
    Domains in SCOPe 2.06: d3d8ca1, d3d8ca2
  • Chain 'B':
    Compound: Hypoxia-inducible factor 1 alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3D8C (Start-18)
  • Heterogens: ZN, SO4, AKG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d8cA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahygeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d8cA (A:)
    vasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtn
    lvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhef
    veklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlll
    igmegnvtpahygeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpd
    yerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkriey
    plkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'B':
    No sequence available.