PDB entry 3d8b

View 3d8b on RCSB PDB site
Description: Crystal structure of human fidgetin-like protein 1 in complex with ADP
Class: hydrolase
Keywords: AAA+, ATPase, ADP, SGC, Structural Genomics Consortium, ATP-binding, Hydrolase, Magnesium, Metal-binding, Nucleotide-binding, Phosphoprotein
Deposited on 2008-05-23, released 2008-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fidgetin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FIGNL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d8ba_
  • Chain 'B':
    Compound: Fidgetin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FIGNL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d8bb_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d8bA (A:)
    mhhhhhhssgvdlgtenlyfqsmvppipkqdggeqnggmqckpygagptepahpvderlk
    nlepkmielimneimdhgppvnwediagvefakatikeivvwpmlrpdiftglrgppkgi
    llfgppgtgktligkciasqsgatffsisassltskwvgegekmvralfavarcqqpavi
    fideidsllsqrgdgehessrrikteflvqldgattssedrilvvgatnrpqeideaarr
    rlvkrlyiplpeasarkqivinlmskeqcclseeeieqivqqsdafsgadmtqlcreasl
    gpirslqtadiatitpdqvrpiayidfenafrtvrpsvspkdlelyenwnktfgcgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d8bA (A:)
    erlknlepkmielimneimdhgppvnwediagvefakatikeivvwpmlrpdiftglrgp
    pkgillfgppgtgktligkciasqsgatffsisassltskwvgegekmvralfavarcqq
    pavifideidsllsqessrrikteflvqldgsedrilvvgatnrpqeideaarrrlvkrl
    yiplpeasarkqivinlmskeqcclseeeieqivqqsdafsgadmtqlcreaslgpirsl
    qtvrpiayidfenafrtvrpsvspkdlelyenwnktfgcgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d8bB (B:)
    mhhhhhhssgvdlgtenlyfqsmvppipkqdggeqnggmqckpygagptepahpvderlk
    nlepkmielimneimdhgppvnwediagvefakatikeivvwpmlrpdiftglrgppkgi
    llfgppgtgktligkciasqsgatffsisassltskwvgegekmvralfavarcqqpavi
    fideidsllsqrgdgehessrrikteflvqldgattssedrilvvgatnrpqeideaarr
    rlvkrlyiplpeasarkqivinlmskeqcclseeeieqivqqsdafsgadmtqlcreasl
    gpirslqtadiatitpdqvrpiayidfenafrtvrpsvspkdlelyenwnktfgcgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d8bB (B:)
    lepkmielimneimdhgppvnwediagvefakatikeivvwpmlrpdiftglrgppkgil
    lfgppgtgktligkciasqsgatffsisassltegekmvralfavarcqqpavifideid
    sllssrrikteflvqldgaedrilvvgatnrpqeideaarrrlvkrlyiplpeasarkqi
    vinlmskeqcclseeeieqivqqsdafsgadmtqlcreaslgpirslqtaatitpdqvrp
    iayidfenafrtvrpsvspkdlelyenwnktfgc