PDB entry 3d87

View 3d87 on RCSB PDB site
Description: Crystal structure of Interleukin-23
Class: cytokine
Keywords: Interleukin-23, FAB, CYTOKINE
Deposited on 2008-05-22, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.269
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-23 subunit p19
    Species: Homo sapiens [TaxId:9606]
    Gene: IL23A, SGRF, UNQ2498/PRO5798
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Interleukin-12 subunit p40
    Species: Homo sapiens [TaxId:9606]
    Gene: IL12B, NKSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29460 (0-305)
      • engineered (199)
    Domains in SCOPe 2.07: d3d87b1, d3d87b2, d3d87b3
  • Chain 'C':
    Compound: Interleukin-23 subunit p19
    Species: Homo sapiens [TaxId:9606]
    Gene: IL23A, SGRF, UNQ2498/PRO5798
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Interleukin-12 subunit p40
    Species: Homo sapiens [TaxId:9606]
    Gene: IL12B, NKSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29460 (0-End)
      • engineered (199)
    Domains in SCOPe 2.07: d3d87d1, d3d87d2, d3d87d3
  • Heterogens: MAN, PO4, K

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d87B (B:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftc
    wwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacpaa
    eeslpievmvdavhklkyeqytssffirdiikpdppknlqlkplknsrqvevsweypdtw
    stphsyfsltfcvqvqgkskrekkdrvftdktsatvicrknasisvraqdryyssswsew
    asvpcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d87B (B:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftc
    wwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacpaa
    eeslpievmvdavhklkyeqytssffirdiikpdppknlqlkplknsrqvevsweypdtw
    stphsyfsltfcvqvqdrvftdktsatvicrknasisvraqdryyssswsewasvpcs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3d87D (D:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftc
    wwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacpaa
    eeslpievmvdavhklkyeqytssffirdiikpdppknlqlkplknsrqvevsweypdtw
    stphsyfsltfcvqvqgkskrekkdrvftdktsatvicrknasisvraqdryyssswsew
    asvpcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d87D (D:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftc
    wwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacpaa
    eeslpievmvdavhklkyeqytssffirdiikpdppknlqlkplknsrqvevsweypdtw
    stphsyfsltfcvqvdrvftdktsatvicrknasisvraqdryyssswsewasvpc