PDB entry 3d7u

View 3d7u on RCSB PDB site
Description: Structural basis for the recognition of c-Src by its inactivator Csk
Class: transferase
Keywords: Csk c-Src Tyrosine kinase, ATP-binding, Cytoplasm, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, Alternative splicing, Lipoprotein, Myristate, Proto-oncogene
Deposited on 2008-05-21, released 2008-08-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: XRAY
Resolution: 4.11 Å
R-factor: 0.294
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase CSK
    Species: Homo sapiens [TaxId:9606]
    Gene: CSK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3d7ua1
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (3-266)
      • expression tag (0-2)
      • expression tag (267-276)
  • Chain 'C':
    Compound: Tyrosine-protein kinase CSK
    Species: Homo sapiens [TaxId:9606]
    Gene: CSK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3d7uc1
  • Chain 'D':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (3-266)
      • expression tag (0-2)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d7uA (A:)
    walnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsn
    lvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyleg
    nnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealrekkfstks
    dvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhlda
    amrpsflqlreqlehikthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d7uA (A:)
    walnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsn
    lvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyleg
    nnfvhrdlaarnvlvsednvakvsdfgltkeasklpvkwtapealrekkfstksdvwsfg
    illweiysfgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhldaamrpsf
    lqlreqlehikthelhl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d7uC (C:)
    walnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsn
    lvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyleg
    nnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealrekkfstks
    dvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhlda
    amrpsflqlreqlehikthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d7uC (C:)
    walnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsn
    lvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyleg
    nnfvhrdlaarnvlvsednvakvsdfgltkeasklpvkwtapealrekkfstksdvwsfg
    illweiysfgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhldaamrpsf
    lqlreqlehikthelhl
    

  • Chain 'D':
    No sequence available.