PDB entry 3d7t

View 3d7t on RCSB PDB site
Description: Structural basis for the recognition of c-Src by its inactivator Csk
Class: transferase
Keywords: CSK SRC TYROSINE KINASE, ATP-binding, Cytoplasm, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, Alternative splicing, Lipoprotein, Myristate, Proto-oncogene
Deposited on 2008-05-21, released 2008-08-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.239
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase CSK
    Species: Homo sapiens [TaxId:9606]
    Gene: CSK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41240 (6-268)
      • engineered (179-180)
    Domains in SCOPe 2.03: d3d7ta_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3d7tb_
  • Heterogens: STU

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d7tA (A:)
    gplgsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmt
    qlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvcea
    meylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealrea
    afstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavyevmkn
    cwhldaamrpsflqlreqlehikthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d7tA (A:)
    walnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsn
    lvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyleg
    nnfvhrdlaarnvlvsednvakvsdfgpvkwtapealreaafstksdvwsfgillweiys
    fgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhldaamrpsflqlreqle
    hikthelhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d7tB (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d7tB (B:)
    daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayv
    ermnyvhrdlraanilvgenlvckvadfglarlikfpikwtapeaalygrftiksdvwsf
    gilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerpt
    feylqafledyftstepqyqpgenl