PDB entry 3d74

View 3d74 on RCSB PDB site
Description: Crystal structure of a pheromone binding protein mutant D35A, from Apis mellifera, soaked at pH 5.5
Class: Pheromone Binding Protein
Keywords: Pheromone binding protein, Honey bee, Apis mellifera, signal transduction, queen mandibular protein, pH
Deposited on 2008-05-20, released 2009-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pheromone-binding protein ASP1
  Species: Apis mellifera [TaxId:7460]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9U9J6 (0-118)
    • engineered (34)
  Domains in SCOPe 2.07: d3d74a_
• Chain 'B':
  Compound: Pheromone-binding protein ASP1
  Species: Apis mellifera [TaxId:7460]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9U9J6 (0-118)
    • engineered (34)
  Domains in SCOPe 2.07: d3d74b_
• Heterogens: NBB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d74A (A:)
  apdwvppevfdlvaedkarcmsehgttqaqiddvakgnlvnepsitcymyclleafslvd
  deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3d74B (B:)
  apdwvppevfdlvaedkarcmsehgttqaqiddvakgnlvnepsitcymyclleafslvd
  deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi