PDB entry 3d6p

View 3d6p on RCSB PDB site
Description: RNase A- 5'-Deoxy-5'-N-morpholinouridine complex
Class: hydrolase
Keywords: Hydrolase, Ribonuclease A, ligand, Endonuclease, Glycation, Glycoprotein, Nuclease, Secreted
Deposited on 2008-05-20, released 2009-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d6pa_
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d6pb_
  • Heterogens: U2S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d6pA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d6pB (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv