PDB entry 3d6d

View 3d6d on RCSB PDB site
Description: Crystal Structure of the complex between PPARgamma LBD and the LT175(R-enantiomer)
Class: transcription
Keywords: bundle of alpha-helices and a small four-stranded beta-sheet, Activator, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger
Deposited on 2008-05-19, released 2008-12-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2008-12-30, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.248
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3d6da_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3d6db_
  • Heterogens: LRG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d6dA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d6dA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d6dB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d6dB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl