PDB entry 3d5t

View 3d5t on RCSB PDB site
Description: Crystal structure of malate dehydrogenase from Burkholderia pseudomallei
Class: oxidoreductase
Keywords: SSGCID, Structural Genomics, NIAID, deCODE biostructures, Malate Dehydrogenase, NAD, Oxidoreductase, Tricarboxylic acid cycle, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2008-05-16, released 2008-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: mdh, BURPS1710b_A0795
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5ta1, d3d5ta2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: mdh, BURPS1710b_A0795
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5tb1, d3d5tb2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: mdh, BURPS1710b_A0795
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5tc1, d3d5tc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: mdh, BURPS1710b_A0795
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d5td1, d3d5td2
  • Heterogens: NA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d5tA (A:)
    gpgsmakpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvm
    elddcafpllagvvitddpkvafkdadvallvgarprskgmerkdllsanaeiftvqgaa
    lnevasrdvkvlvvgnpantnayiamksapdlpkknftamlrldhnralsqlaaksgkpv
    asieklavwgnhsptmypdfrfataegesllklinddvwnrdtfiptvgkrgaaiiearg
    lssaasaanaaidhvrdwvlgtngkwvtmgipsdgsygipediiygvpvicengeykrve
    gleidafsrekmdgtlaelleerdgvahllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5tA (A:)
    kpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvmelddca
    fpllagvvitddpkvafkdadvallvgarprsmerkdllsanaeiftvqgaalnevasrd
    vkvlvvgnpantnayiamksapdlpkknftamlrldhnralsqlaaksgkpvasieklav
    wgnhsptmypdfrfataegesllklinddvwnrdtfiptvgkrgaaiiearglssaasaa
    naaidhvrdwvlgtngkwvtmgipsdgsygipediiygvpvicengeykrvegleidafs
    rekmdgtlaelleerdgvahl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d5tB (B:)
    gpgsmakpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvm
    elddcafpllagvvitddpkvafkdadvallvgarprskgmerkdllsanaeiftvqgaa
    lnevasrdvkvlvvgnpantnayiamksapdlpkknftamlrldhnralsqlaaksgkpv
    asieklavwgnhsptmypdfrfataegesllklinddvwnrdtfiptvgkrgaaiiearg
    lssaasaanaaidhvrdwvlgtngkwvtmgipsdgsygipediiygvpvicengeykrve
    gleidafsrekmdgtlaelleerdgvahllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5tB (B:)
    kpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvmelddca
    fpllagvvitddpkvafkdadvallvgarprsmerkdllsanaeiftvqgaalnevasrd
    vkvlvvgnpantnayiamksapdlpkknftamlrldhnralsqlaaksgkpvasieklav
    wgnhsptmypdfrfataegesllklinddvwnrdtfiptvgkrgaaiiearglssaasaa
    naaidhvrdwvlgtngkwvtmgipsdgsygipediiygvpvicengeykrvegleidafs
    rekmdgtlaelleerdgvahl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d5tC (C:)
    gpgsmakpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvm
    elddcafpllagvvitddpkvafkdadvallvgarprskgmerkdllsanaeiftvqgaa
    lnevasrdvkvlvvgnpantnayiamksapdlpkknftamlrldhnralsqlaaksgkpv
    asieklavwgnhsptmypdfrfataegesllklinddvwnrdtfiptvgkrgaaiiearg
    lssaasaanaaidhvrdwvlgtngkwvtmgipsdgsygipediiygvpvicengeykrve
    gleidafsrekmdgtlaelleerdgvahllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5tC (C:)
    kpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvmelddca
    fpllagvvitddpkvafkdadvallvgarprskgmerkdllsanaeiftvqgaalnevas
    rdvkvlvvgnpantnayiamksapdlpkknftamlrldhnralsqlaaksgkpvasiekl
    avwgnhsptmypdfrfataegesllklinddvwnrdtfiptvgkrgaaiiearglssaas
    aanaaidhvrdwvlgtngkwvtmgipsdgsygipediiygvpvicengeykrvegleida
    fsrekmdgtlaelleerdgvahl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3d5tD (D:)
    gpgsmakpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvm
    elddcafpllagvvitddpkvafkdadvallvgarprskgmerkdllsanaeiftvqgaa
    lnevasrdvkvlvvgnpantnayiamksapdlpkknftamlrldhnralsqlaaksgkpv
    asieklavwgnhsptmypdfrfataegesllklinddvwnrdtfiptvgkrgaaiiearg
    lssaasaanaaidhvrdwvlgtngkwvtmgipsdgsygipediiygvpvicengeykrve
    gleidafsrekmdgtlaelleerdgvahllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5tD (D:)
    kpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvmelddca
    fpllagvvitddpkvafkdadvallvgarprsmerkdllsanaeiftvqgaalnevasrd
    vkvlvvgnpantnayiamksapdlpkknftamlrldhnralsqlaaksgkpvasieklav
    wgnhsptmypdfrfataegesllklinddvwnrdtfiptvgkrgaaiiearglssaasaa
    naaidhvrdwvlgtngkwvtmgipsdgsygipediiygvpvicengeykrvegleidafs
    rekmdgtlaelleerdgvahl