PDB entry 3d5h

View 3d5h on RCSB PDB site
Description: Crystal structure of haementhin from Haemanthus multiflorus at 2.0A resolution: Formation of a novel loop on a TIM barrel fold and its functional significance
Class: protein binding
Keywords: TIM barrel, PROTEIN BINDING
Deposited on 2008-05-16, released 2009-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.154
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haementhin
    Species: Scadoxus multiflorus [TaxId:82246]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3d5ha_
  • Heterogens: ACT, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d5hA (A:)
    anldiavywgqnfdersleatcdtgnyayviigflntfgggqtpaldisghspsglepqi
    khcqsknvkvllsiggpkgpysldsrsdandlavylfnnfllppghsenrpfgnavldgi
    dfhiehggpsqyqllanilssfrlagtefaltaapqcvypdpnlgtvinsatfdaiwvqf
    ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppekvkfhvfpa
    akksykfggimlwdsywdtvsnfsskilgegw