PDB entry 3d5f

View 3d5f on RCSB PDB site
Description: Crystal Structure of PPAR-delta complex
Class: transcription
Keywords: Nuclear Receptor, Activator, Alternative splicing, DNA-binding, Metal-binding, Nucleus, Transcription, Transcription regulation, Zinc, Zinc-finger
Deposited on 2008-05-16, released 2008-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.278
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-End)
      • engineered (219)
    Domains in SCOPe 2.06: d3d5fa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-266)
      • engineered (219)
    Domains in SCOPe 2.06: d3d5fb_
  • Heterogens: L41, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d5fA (A:)
    lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5fA (A:)
    lkafskhiynaylknfnmtkkkarsiltgpfvihdietlwqaekglvwlppykeisvhvf
    yrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllva
    ngsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmn
    vprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqrikktete
    tslhpllqeiykdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d5fB (B:)
    lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
    lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
    asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
    iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
    qmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d5fB (B:)
    lkafskhiynaylknfnmtkkkarsiltpfvihdietlwqaekglvwlppykeisvhvfy
    rcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvan
    gsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnv
    prveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqrikktetet
    slhpllqeiykdmy