PDB entry 3d57

View 3d57 on RCSB PDB site
Description: TR Variant D355R
Class: hormone, transcription receptor
Keywords: thyroid hormone receptor, ligand binding domain, D355R mutant, homodimer, Alternative splicing, Deafness, Disease mutation, DNA-binding, Metal-binding, Nucleus, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, HORMONE, TRANSCRIPTION RECEPTOR
Deposited on 2008-05-15, released 2008-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thyroid hormone receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: 7068, ERBA2, NR1A2, THR1, THRB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10828 (Start-265)
      • engineered (160)
    Domains in SCOPe 2.06: d3d57a_
  • Chain 'B':
    Compound: Thyroid hormone receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: 7068, ERBA2, NR1A2, THR1, THRB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10828 (Start-265)
      • engineered (160)
    Domains in SCOPe 2.06: d3d57b_
  • Heterogens: 4HY, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d57A (A:)
    mgsshhhhhhsqdpghkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqap
    ivnapeggkvdleafshftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeims
    lraavrydpesetltlngemavtrgqlkngglgvvsdaifrlgmslssfnlddtevallq
    avllmssdrpglacveriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigac
    hasrflhmkvecptelfpplflevfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d57A (A:)
    hkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapggkvdleafshftki
    itpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlngema
    vtrgqlkngglgvvsdaifrlgmslssfnlddtevallqavllmssdrpglacverieky
    qdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpplf
    levfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d57B (B:)
    mgsshhhhhhsqdpghkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqap
    ivnapeggkvdleafshftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeims
    lraavrydpesetltlngemavtrgqlkngglgvvsdaifrlgmslssfnlddtevallq
    avllmssdrpglacveriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigac
    hasrflhmkvecptelfpplflevfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d57B (B:)
    kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapiapeggkvdleafshf
    tkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlng
    emavtrgqlkngglgvvsdaifrlgmslssfnlddtevallqavllmssdrpglacveri
    ekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfp
    plflevfe