PDB entry 3d4j

View 3d4j on RCSB PDB site
Description: Crystal structure of Human mevalonate diphosphate decarboxylase
Class: lyase
Keywords: Mevalonate Diphosphate Decarboxylase, Isopentenyl Diphosphate, carboxylation, Cholesterol biosynthesis, Lipid synthesis, Lyase, Phosphoprotein, Steroid biosynthesis, Sterol biosynthesis
Deposited on 2008-05-14, released 2008-12-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2008-12-16, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diphosphomevalonate decarboxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: MVD, MPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3d4ja1, d3d4ja2
  • Chain 'B':
    Compound: Diphosphomevalonate decarboxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: MVD, MPD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3d4jb1, d3d4jb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d4jA (A:)
    masekplaavtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdf
    tedriwlngreedvgqprlqaclreirclarkrrnsrdgdplpsslsckvhvasvnnfpt
    aaglassaagyaclaytlarvygvesdlsevarrgsgsacrslyggfvewqmgeqadgkd
    siarqvapeshwpelrvlilvvsaekkltgstvgmrasvetspllrfraesvvparmaem
    arcirerdfpsfaqltmkdsnqfhatcldtfppisylnaiswriihlvhrfnahhgdtkv
    aytfdagpnaviftlddtvaefvaavwhgfppgsngdtflkglqvrpaplsaelqaalam
    eptpggvkyiivtqvgpgpqilddpcahllgpdglpkpaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4jA (A:)
    aavtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdftedriwl
    ngreedvgqprlqaclreirclarsckvhvasvnnfptaaglassaagyaclaytlarvy
    gvesdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqvapeshwpelrvlilvv
    saekkltgstvgmrasvetspllrfraesvvparmaemarcirerdfpsfaqltmkdsnq
    fhatcldtfppisylnaiswriihlvhrfnahhgdtkvaytfdagpnaviftlddtvaef
    vaavwhgfppgsngdtflkglqvrpaplsaelqaalameptpggvkyiivtqvgpgpqil
    ddpcahllgpdglp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d4jB (B:)
    masekplaavtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdf
    tedriwlngreedvgqprlqaclreirclarkrrnsrdgdplpsslsckvhvasvnnfpt
    aaglassaagyaclaytlarvygvesdlsevarrgsgsacrslyggfvewqmgeqadgkd
    siarqvapeshwpelrvlilvvsaekkltgstvgmrasvetspllrfraesvvparmaem
    arcirerdfpsfaqltmkdsnqfhatcldtfppisylnaiswriihlvhrfnahhgdtkv
    aytfdagpnaviftlddtvaefvaavwhgfppgsngdtflkglqvrpaplsaelqaalam
    eptpggvkyiivtqvgpgpqilddpcahllgpdglpkpaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d4jB (B:)
    avtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdftedriwln
    greedvgqprlqaclreirclackvhvasvnnfptlassaagyaclaytlarvygvesdl
    sevarrgsgsacrslyggfvewqmgeqadgkdsiarqvapeshwpelrvlilvvsaekkl
    tgstvgmrasvetspllrfraesvvparmaemarcirerdfpsfaqltmkdsnqfhatcl
    dtfppisylnaiswriihlvhrfnahhgdtkvaytfdagpnaviftlddtvaefvaavwh
    gfppgsngdtflkglqvrpaplsaelqaalameptpggvkyiivtqvgpgpqilddpcah
    llgpdglp