PDB entry 3d38

View 3d38 on RCSB PDB site
Description: Crystal structure of new trigonal form of photosynthetic reaction center from Blastochloris viridis. Crystals grown in microfluidics by detergent capture.
Class: photosynthesis
Keywords: detergent extraction, reaction center, microfludics, plugs, Structural Genomics, PSI-2, Protein Structure Initiative, Accelerated Technologies Center for Gene to 3D Structure, ATCG3D, Electron transport, Heme, Iron, Lipoprotein, Membrane, Metal-binding, Photosynthesis, Transport, Bacteriochlorophyll, Chlorophyll, Chromophore, Formylation, Transmembrane, Magnesium
Deposited on 2008-05-09, released 2008-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: 0.194
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d38c1
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d38h1, d3d38h2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d38l1
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Blastochloris viridis [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3d38m1
  • Heterogens: SO4, FE2, HEC, HTO, LDA, BCB, BPB, UQ1, MQ9, NS5, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3d38C (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpikaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d38C (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3d38H (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaesll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d38H (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplvepedgqvyelpypktf
    vlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaeraevvdatv
    dgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyfrylelsva
    gsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsayyagglly
    atperaesll
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d38L (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d38M (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk