PDB entry 3d1x

View 3d1x on RCSB PDB site
Description: Crystal structure of HIV-1 mutant I54M and inhibitor saquinavir
Class: hydrolase/hydrolase inhibitor
Keywords: DRUG RESISTANCE, HIV-1, I54M, Flap mutant, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, Hydrolase-hydrolase inhibitor complex, Viral nucleoprotein
Deposited on 2008-05-06, released 2008-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.155
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • see remark 999 (32)
      • engineered (53)
      • see remark 999 (62)
      • see remark 999 (66)
      • see remark 999 (94)
    Domains in SCOPe 2.06: d3d1xa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus type 1
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • see remark 999 (32)
      • engineered (53)
      • see remark 999 (62)
      • see remark 999 (66)
      • see remark 999 (94)
    Domains in SCOPe 2.06: d3d1xb_
  • Heterogens: CL, ROC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d1xA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3d1xB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf