PDB entry 3d1x
View 3d1x on RCSB PDB site
Description: Crystal structure of HIV-1 mutant I54M and inhibitor saquinavir
Class: hydrolase/hydrolase inhibitor
Keywords: DRUG RESISTANCE, HIV-1, I54M, Flap mutant, AIDS, Aspartyl protease, Capsid maturation, Capsid protein, Hydrolase-hydrolase inhibitor complex, Viral nucleoprotein
Deposited on
2008-05-06, released
2008-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.155
AEROSPACI score: 0.95
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- see remark 999 (32)
- engineered (53)
- see remark 999 (62)
- see remark 999 (66)
- see remark 999 (94)
Domains in SCOPe 2.06: d3d1xa_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus type 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- see remark 999 (32)
- engineered (53)
- see remark 999 (62)
- see remark 999 (66)
- see remark 999 (94)
Domains in SCOPe 2.06: d3d1xb_ - Heterogens: CL, ROC, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3d1xA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3d1xB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfmkvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf