PDB entry 3d0s

View 3d0s on RCSB PDB site
Description: cAMP receptor protein from m.tuberculosis, cAMP-free form
Class: transcription
Keywords: CAMP RECEPTOR PROTEIN (CRP), DIMER, INACTIVE(APO, UNLIGANDED) FORM, ALLOSTERY, DNA BINDING, CYCLIC AMP, TRANSCRIPTION REGULATION, CATABOLITE GENE ACTIVATOR PROTEIN, DNA-binding, Nucleotide-binding, Transcription
Deposited on 2008-05-02, released 2009-02-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulatory protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT3777, Rv3676
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3d0sa1, d3d0sa2
  • Chain 'B':
    Compound: transcriptional regulatory protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT3777, Rv3676
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.04: d3d0sb1, d3d0sb2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d0sA (A:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d0sA (A:)
    mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
    apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
    eqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqeei
    aqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d0sB (B:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d0sB (B:)
    gshmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvki
    grrapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrp
    eiseqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltq
    eeiaqlvgasretvnkaladfahrgwirlegksvlisd