PDB entry 3d0n

View 3d0n on RCSB PDB site
Description: Crystal structure of human carbonic anhydrase XIII
Class: metal binding protein
Keywords: Carbonic anhydrase, Lyase, Metal-binding, METAL BINDING PROTEIN
Deposited on 2008-05-02, released 2008-07-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.168
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3d0na_
  • Chain 'B':
    Compound: Carbonic anhydrase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3d0nb_
  • Heterogens: ZN, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3d0nA (A:)
    gsmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssak
    iisnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaae
    lhvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrft
    nfdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegea
    aaflvsnhrppqplkgrkvrasfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d0nA (A:)
    smsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssaki
    isnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaael
    hvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftn
    fdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaa
    aflvsnhrppqplkgrkvrasfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3d0nB (B:)
    gsmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssak
    iisnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaae
    lhvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrft
    nfdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegea
    aaflvsnhrppqplkgrkvrasfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3d0nB (B:)
    smsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssaki
    isnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaael
    hvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftn
    fdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaa
    aflvsnhrppqplkgrkvrasfh