PDB entry 3czv

View 3czv on RCSB PDB site
Description: Crystal structure of the human carbonic anhydrase XIII in complex with acetazolamide
Class: lyase
Keywords: Carbonic anhydrase, Protein-inhibitor complex, Lyase, Metal-binding
Deposited on 2008-04-30, released 2008-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3czva_
  • Chain 'B':
    Compound: Carbonic anhydrase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CA13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3czvb_
  • Heterogens: ZN, AZM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3czvA (A:)
    gsmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssak
    iisnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaae
    lhvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrft
    nfdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegea
    aaflvsnhrppqplkgrkvrasfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3czvA (A:)
    swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg
    hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw
    nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls
    llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs
    nhrppqplkgrkvrasfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3czvB (B:)
    gsmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssak
    iisnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaae
    lhvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrft
    nfdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegea
    aaflvsnhrppqplkgrkvrasfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3czvB (B:)
    lswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisns
    ghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvh
    wnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdll
    sllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflv
    snhrppqplkgrkvrasf