PDB entry 3cz5

View 3cz5 on RCSB PDB site
Description: Crystal structure of two-component response regulator, LuxR family, from Aurantimonas sp. SI85-9A1
Class: transcription regulator
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, response regulator, LuxR family, PSI-2, DNA-binding, Transcription, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2008-04-28, released 2008-05-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Two-component response regulator, LuxR family
    Species: Aurantimonas sp. [TaxId:314269]
    Gene: SI859A1_03491
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cz5a_
  • Chain 'B':
    Compound: Two-component response regulator, LuxR family
    Species: Aurantimonas sp. [TaxId:314269]
    Gene: SI859A1_03491
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cz5b_
  • Chain 'C':
    Compound: Two-component response regulator, LuxR family
    Species: Aurantimonas sp. [TaxId:314269]
    Gene: SI859A1_03491
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cz5c_
  • Chain 'D':
    Compound: Two-component response regulator, LuxR family
    Species: Aurantimonas sp. [TaxId:314269]
    Gene: SI859A1_03491
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cz5d_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cz5A (A:)
    mslstarimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdlt
    lpgpggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaie
    ailagrramspdiaqeiaeervegreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cz5A (A:)
    starimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdltlpg
    pggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaieail
    agrramspdiaqeiaeerveg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cz5B (B:)
    mslstarimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdlt
    lpgpggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaie
    ailagrramspdiaqeiaeervegreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cz5B (B:)
    starimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdltlpg
    pggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaieail
    agrramspdiaqeiaeerve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cz5C (C:)
    mslstarimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdlt
    lpgpggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaie
    ailagrramspdiaqeiaeervegreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cz5C (C:)
    starimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdltlpg
    pggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaieail
    agrramspdiaqeiaeervegr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cz5D (D:)
    mslstarimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdlt
    lpgpggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaie
    ailagrramspdiaqeiaeervegreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cz5D (D:)
    starimlvddhpivregyrrlierrpgyavvaeaadageayrlyrettpdivvmdltlpg
    pggieatrhirqwdgaariliftmhqgsafalkafeagasgyvtkssdpaelvqaieail
    agrramspdiaqeiaeervegr