PDB entry 3cyt

View 3cyt on RCSB PDB site
Description: redox conformation changes in refined tuna cytochrome c
Deposited on 1980-07-01, released 1980-09-16
The last revision prior to the SCOP 1.63 freeze date was dated 1983-09-30, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Domains in SCOP 1.63: d3cyti_
  • Chain 'O':
    Domains in SCOP 1.63: d3cyto_

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cytI (I:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cytO (O:)
    gdvakgkktfvqkcaqchtvenggkhkvgpnlwglfgrktgqaegysytdankskgivwn
    ndtlmeylenpkkyipgtkmifagikkkgerqdlvaylksats