PDB entry 3cx3

View 3cx3 on RCSB PDB site
Description: Crystal structure Analysis of the Streptococcus pneumoniae AdcAII protein
Class: metal binding protein
Keywords: zinc-binding, Lipoprotein, Transport, LIPID BINDING PROTEIN, METAL BINDING PROTEIN
Deposited on 2008-04-23, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene: lmb, spr0906
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cx3a_
  • Chain 'B':
    Compound: Lipoprotein
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene: lmb, spr0906
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cx3b_
  • Heterogens: NA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cx3A (A:)
    gqkesqtgkgmkivtsfypiyamvkevsgdlndvrmiqsssgihsfepsandiaaiydad
    vfvyhshtleswagsldpnlkkskvkvleasegmtlervpgledveagdgvdektlydph
    twldpekageeaqiiadklsevdsehketyqknaqafikkaqeltkkfqpkfekatqktf
    vtqhtafsylakrfglnqlgiagispeqepsprqlteiqefvktykvktiftesnasskv
    aetlvkstgvglktlnplesdpqndktylenleenmsilaeelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cx3A (A:)
    tgkgmkivtsfypiyamvkevsgdlndvrmiqsssgihsfepsandiaaiydadvfvyhs
    htleswagsldpnlkkskvkvleasegmtlervpgtlydphtwldpekageeaqiiadkl
    sevdsehketyqknaqafikkaqeltkkfqpkfekatqktfvtqhtafsylakrfglnql
    giagispeqepsprqlteiqefvktykvktiftesnasskvaetlvkstgvglktlnple
    sdpqndktylenleenmsilaeel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cx3B (B:)
    gqkesqtgkgmkivtsfypiyamvkevsgdlndvrmiqsssgihsfepsandiaaiydad
    vfvyhshtleswagsldpnlkkskvkvleasegmtlervpgledveagdgvdektlydph
    twldpekageeaqiiadklsevdsehketyqknaqafikkaqeltkkfqpkfekatqktf
    vtqhtafsylakrfglnqlgiagispeqepsprqlteiqefvktykvktiftesnasskv
    aetlvkstgvglktlnplesdpqndktylenleenmsilaeelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cx3B (B:)
    kgmkivtsfypiyamvkevsgdlndvrmiqsssgihsfepsandiaaiydadvfvyhsht
    leswagsldpnlkkskvkvleasegmtlervpgtlydphtwldpekageeaqiiadklse
    vdsehketyqknaqafikkaqeltkkfqpkfekatqktfvtqhtafsylakrfglnqlgi
    agispeqepsprqlteiqefvktykvktiftesnasvaetlvkstgvglktlnplesdpn
    dktylenleenmsilaeelk