PDB entry 3cwv

View 3cwv on RCSB PDB site
Description: Crystal structure of B-subunit of the DNA gyrase from Myxococcus xanthus
Class: isomerase
Keywords: structural genomics, UNKNOWN FUNCTION, DNA Gyrase, B-Subunit, ATP-binding, Isomerase, Nucleotide-binding, Topoisomerase, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2008-04-22, released 2008-05-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.211
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase, B subunit, truncated
    Species: Myxococcus xanthus [TaxId:246197]
    Gene: MXAN_5971
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cwva1, d3cwva2
  • Chain 'B':
    Compound: DNA gyrase, B subunit, truncated
    Species: Myxococcus xanthus [TaxId:246197]
    Gene: MXAN_5971
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cwvb1, d3cwvb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cwvA (A:)
    mslgmhlpggivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevgg
    dgsialfctsrtvtaenlvrvatgagflgrppgdgwgwdsmlvvslalssryqvdiwadg
    rqwrvmgehghpqgegaavtpmepmpvsaergvrvhfvpdatifevlafdrarlsrrcne
    laalapglrvsfadlqrgertlwhlpggvaqwahvltearpqlhpepvvfdftwdglrvq
    calqwcededstllsfanavrtvrhgahvkgvtqalrgalaklsgetrgafpwarvaqgl
    taivavsgprrqmafagptkellaipgleeairkqlqplfiellrehpvtpallarrtsg
    seghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cwvA (A:)
    ggivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevggdgsialfc
    tsrtvtaenlvrvatgagflgrppgdgwgwdsmlvvslalssryqvdiwadgrqwrvmge
    hghpqgegaavtpmepmpvsaergvrvhfvpdatifevlafdrarlsrrcnelaalapgl
    rvsfadlqrgertlwhlpggvaqwahvltearpqlhpepvvfdftwdglrvqcalqwced
    edstllsfanavrtvrhgahvkgvtqalrgalaklsgetrgafpwarvaqgltaivavsg
    prrqmafagptkellaipgleeairkqlqplfiellrehpvtpallarr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cwvB (B:)
    mslgmhlpggivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevgg
    dgsialfctsrtvtaenlvrvatgagflgrppgdgwgwdsmlvvslalssryqvdiwadg
    rqwrvmgehghpqgegaavtpmepmpvsaergvrvhfvpdatifevlafdrarlsrrcne
    laalapglrvsfadlqrgertlwhlpggvaqwahvltearpqlhpepvvfdftwdglrvq
    calqwcededstllsfanavrtvrhgahvkgvtqalrgalaklsgetrgafpwarvaqgl
    taivavsgprrqmafagptkellaipgleeairkqlqplfiellrehpvtpallarrtsg
    seghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cwvB (B:)
    ivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevggdgsialfcts
    smlvvslalssryqvdiwdgrqwrvmgehghpqgmepmpvsaergvrvhfvpdatifevl
    afdrarlsrrcnelaalapglrvsfadlqrgertlwhlpggvaqwahvltearpqlhpep
    vvfdftwdglrvqcalqwcededstllsfanavrtvrhgahvkgvtqalrgalaklsget
    rgafpwarvaqgltaivavsgprrqmafagptkellaipgleeairkqlqplfiellreh
    pvtpallarrt