PDB entry 3cwe

View 3cwe on RCSB PDB site
Description: PTP1B in complex with a phosphonic acid inhibitor
Class: hydrolase
Keywords: PHOSPHATASE, PHOSPHONATES, DIABETES, INHIBITOR, Acetylation, Endoplasmic reticulum, Hydrolase, Membrane, Oxidation, Phosphoprotein, Polymorphism, Protein phosphatase
Deposited on 2008-04-21, released 2008-06-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.177
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: HOMO SAPIENS
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (7-289)
      • expression tag (0-6)
    Domains in SCOPe 2.04: d3cwea_
  • Heterogens: MG, 825, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cweA (A:)
    aadklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfd
    hsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrv
    mekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilh
    fhyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtcll
    lmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cweA (A:)
    aadklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfd
    hsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrv
    mkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhytt
    wpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkr
    kdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg