PDB entry 3cwb

View 3cwb on RCSB PDB site
Description: Chicken Cytochrome BC1 Complex inhibited by an iodinated analogue of the polyketide Crocacin-D
Class: oxidoreductase
Keywords: Crocacin D, inhibitor design, structure-activity relationship, polyketide, fungicide, CYTOCHROME BC1, MEMBRANE PROTEIN, HEME PROTEIN, RIESKE IRON SULFUR PROTEIN, CYTOCHROME B, CYTOCHROME C1, COMPLEX III, MITOCHONDRIAL PROCESSING PROTEA UBIQUINONE, OXIDOREDUCTASE, REDOX ENZYME, RESPIRATORY CHAIN, Electron transport, Heme, Inner membrane, Iron, Membrane, Metal-binding, Mitochondrion, Transmembrane, Transport
Deposited on 2008-04-21, released 2008-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 3.51 Å
R-factor: 0.285
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB
  • Chain 'B':
    Compound: Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (Start-440)
  • Chain 'C':
    Compound: cytochrome b
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cwbc1, d3cwbc2
  • Chain 'D':
    Compound: Mitochondrial cytochrome c1, heme protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (0-240)
  • Chain 'E':
    Compound: mitochondrial ubiquinol-cytochrome c reductase iron-sulfur protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (0-195)
  • Chain 'F':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB
  • Chain 'G':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (0-80)
  • Chain 'H':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (Start-76)
  • Chain 'I':
    Compound: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT, leader sequence
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (0-60)
  • Chain 'N':
    Compound: Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB
  • Chain 'O':
    Compound: Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (Start-440)
  • Chain 'P':
    Compound: cytochrome b
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cwbp1, d3cwbp2
  • Chain 'Q':
    Compound: Mitochondrial cytochrome c1, heme protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (0-240)
  • Chain 'R':
    Compound: mitochondrial ubiquinol-cytochrome c reductase iron-sulfur protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (0-195)
  • Chain 'S':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB
  • Chain 'T':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (0-End)
  • Chain 'U':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (Start-76)
  • Chain 'V':
    Compound: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR SUBUNIT, leader sequence
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CWB (0-End)
  • Heterogens: BOG, AZI, HEM, PEE, ICX, UQ, HEC, CDL, FES, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cwbC (C:)
    mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
    slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
    lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
    alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
    ltlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvl
    ilflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyf
    tillilfptigtlenkmlny
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3cwbP (P:)
    mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
    slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
    lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
    alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
    ltlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvl
    ilflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyf
    tillilfptigtlenkmlny
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cwbP (P:)
    apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
    lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
    ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
    lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
    tlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvli
    lflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyft
    illilfptigtlenkmlny
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.