PDB entry 3cw2

View 3cw2 on RCSB PDB site
Description: Crystal structure of the intact archaeal translation initiation factor 2 from Sulfolobus solfataricus .
Class: translation
Keywords: AIF2, INTACT AIF2, INITIATION FACTOR 2 ALPHA SUBUNIT, INITIATION FACTOR 2 BETA SUBUNIT, INITIATION FACTOR 2 GAMMA SUBUNIT, INITIATION OF THE TRANSLATION, Initiation factor, Protein biosynthesis, RNA-binding, GTP-binding, Nucleotide-binding
Deposited on 2008-04-21, released 2009-01-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-01-06, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cw2a1, d3cw2a2, d3cw2a3
  • Chain 'B':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cw2b1, d3cw2b2, d3cw2b3
  • Chain 'C':
    Compound: Translation initiation factor 2 subunit alpha
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2a, SSO1050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cw2c1, d3cw2c2, d3cw2c3
  • Chain 'D':
    Compound: Translation initiation factor 2 subunit alpha
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2a, SSO1050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cw2d1, d3cw2d2, d3cw2d3
  • Chain 'E':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cw2e1, d3cw2e2, d3cw2e3
  • Chain 'F':
    Compound: Translation initiation factor 2 subunit gamma
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g, SSO0412
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cw2f1, d3cw2f2, d3cw2f3
  • Chain 'G':
    Compound: Translation initiation factor 2 subunit alpha
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2a, SSO1050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cw2g1, d3cw2g2, d3cw2g3
  • Chain 'H':
    Compound: Translation initiation factor 2 subunit alpha
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2a, SSO1050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cw2h1, d3cw2h2, d3cw2h3
  • Chain 'K':
    Compound: Translation initiation factor 2 subunit beta
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2b, SSO2381
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Translation initiation factor 2 subunit beta
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2b, SSO2381
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Translation initiation factor 2 subunit beta
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2b, SSO2381
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Translation initiation factor 2 subunit beta
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2b, SSO2381
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cw2A (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cw2A (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cw2B (B:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cw2B (B:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtstiklgyaetnigvcesckkpeayvte
    psckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtre
    hfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkini
    dsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdq
    eikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnl
    lgsiitladaevpvlwnirikynllgakemlkvdpiraketlmlsvgssttlgivtsvkk
    deievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cw2C (C:)
    miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke
    nrkvivkvirvdrrkgtvdvslkkvtdderrkknlqwkkiqrldkilelvsqklklsekd
    aweqvawkleakygdpitaiekavkegekilidagvpeiwvkplleeaskhaeerkvkms
    glitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtnpkeas
    ealnqiisnlikigkeenvdisvvkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cw2D (D:)
    miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke
    nrkvivkvirvdrrkgtvdvslkkvtdderrkknlqwkkiqrldkilelvsqklklsekd
    aweqvawkleakygdpitaiekavkegekilidagvpeiwvkplleeaskhaeerkvkms
    glitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtnpkeas
    ealnqiisnlikigkeenvdisvvkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cw2E (E:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cw2E (E:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cw2F (F:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cw2F (F:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cw2G (G:)
    miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke
    nrkvivkvirvdrrkgtvdvslkkvtdderrkknlqwkkiqrldkilelvsqklklsekd
    aweqvawkleakygdpitaiekavkegekilidagvpeiwvkplleeaskhaeerkvkms
    glitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtnpkeas
    ealnqiisnlikigkeenvdisvvkk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cw2H (H:)
    miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke
    nrkvivkvirvdrrkgtvdvslkkvtdderrkknlqwkkiqrldkilelvsqklklsekd
    aweqvawkleakygdpitaiekavkegekilidagvpeiwvkplleeaskhaeerkvkms
    glitvrtneplgvekikeviskalenieqdyesllnikiytigapryrvdvvgtnpkeas
    ealnqiisnlikigkeenvdisvvkk
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.