PDB entry 3cvh

View 3cvh on RCSB PDB site
Description: How TCR-like antibody recognizes MHC-bound peptide
Class: immune system
Keywords: MHC, TCR, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Allergen, Phosphoprotein, Secreted, Immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2008-04-18, released 2008-09-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.223
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cvha1, d3cvha2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cvhb_
  • Chain 'C':
    Compound: Ovalbumin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 25-D1.16 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CVH (0-218)
    Domains in SCOPe 2.03: d3cvhh1
  • Chain 'L':
    Compound: 25-D1.16 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CVH (0-208)
    Domains in SCOPe 2.03: d3cvhl1, d3cvhl2
  • Chain 'M':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cvhm1, d3cvhm2
  • Chain 'N':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cvhn_
  • Chain 'O':
    Compound: Ovalbumin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 25-D1.16 Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CVH (0-218)
    Domains in SCOPe 2.03: d3cvhq1
  • Chain 'R':
    Compound: 25-D1.16 Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CVH (0-208)
    Domains in SCOPe 2.03: d3cvhr1, d3cvhr2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cvhA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cvhB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cvhH (H:)
    vllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigdinpnnggtiyn
    qkfkgkatltvdksssaaymevrsltsedtavyycarkpyygnfawfaywgqgtlvtvsa
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cvhH (H:)
    vllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigdinpnnggtiyn
    qkfkgkatltvdksssaaymevrsltsedtavyycarkpyygnfawfaywgqgtlvtvsa
    akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cvhL (L:)
    iqvtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpdr
    fsgsgsrkdytliitslqtedvatyycqqywstpltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfn
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cvhM (M:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cvhN (N:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'O':
    No sequence available.

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3cvhQ (Q:)
    vllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigdinpnnggtiyn
    qkfkgkatltvdksssaaymevrsltsedtavyycarkpyygnfawfaywgqgtlvtvsa
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cvhQ (Q:)
    vllqqsgpelvkpgasvkipckasgytftdynmdwvkqshgkslewigdinpnnggtiyn
    qkfkgkatltvdksssaaymevrsltsedtavyycarkpyygnfawfaywgqgtlvtvsa
    akttppsvyplapvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
    vpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cvhR (R:)
    iqvtqssssfsvslgdrvtitckasediynrlawyqqkpgnaprllisgatsletgvpdr
    fsgsgsrkdytliitslqtedvatyycqqywstpltfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfn