PDB entry 3cuq

View 3cuq on RCSB PDB site
Description: Integrated structural and functional model of the human ESCRT-II complex
Class: protein transport
Keywords: ESCRT, Sorting, MBV, vps, Nucleus, Protein transport, Transcription, Transcription regulation, Transport, Endosome, Lipid-binding
Deposited on 2008-04-16, released 2008-11-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.241
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Vacuolar-sorting protein SNF8
  Species: Homo sapiens [TaxId:9606]
  Gene: SNF8, EAP30
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96H20
  Domains in SCOPe 2.03: d3cuqa1, d3cuqa2
• Chain 'B':
  Compound: Vacuolar protein-sorting-associated protein 36
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS36, C13orf9, EAP45
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86VN1
• Chain 'C':
  Compound: Vacuolar protein-sorting-associated protein 25
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS25, DERP9, EAP20
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BRG1 (Start-175)
• Chain 'D':
  Compound: Vacuolar protein-sorting-associated protein 25
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS25, DERP9, EAP20
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BRG1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3cuqA (A:)
  gtvlaedqlaqmskqldmfktnleefaskhkqeirknpefrvqfqdmcatigvdplasgk
  gfwsemlgvgdfyyelgvqiievclalkhrngglitleelhqqvlkgrgkfaqdvsqddl
  iraikklkalgtgfgiipvggtyliqsvpaelnmdhtvvlqlaekngyvtvseikaslkw
  eterarqvlehllkeglawldlqapgeahywlpalftdlysqeitaeearealp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3cuqA (A:)
  aqmskqldmfktnleefaskhkqeirknpefrvqfqdmcatigvdplasgkgfwsemlgv
  gdfyyelgvqiievclalkhrngglitleelhqqvlkgrgkfaqdvsqddliraikklka
  lgtgfgiipvggtyliqsvpaelnmdhtvvlqlaekngyvtvseikaslkweterarqvl
  ehllkeglawldlqapgeahywlpalftdlysqeitaee
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.