PDB entry 3cul

View 3cul on RCSB PDB site
Description: Aminoacyl-tRNA synthetase ribozyme
Class: RNA/RNA binding
Keywords: catalytic RNA ribozyme ARS, RNA/RNA binding COMPLEX
Deposited on 2008-04-16, released 2008-06-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.05: d3cula_
  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (Start-95)
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.05: d3culb_
  • Chain 'C':
    Compound: RNA (92-mer)
  • Chain 'D':
    Compound: RNA (92-mer)
  • Heterogens: MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3culA (A:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3culA (A:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3culB (B:)
    mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3culB (B:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiak
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.