PDB entry 3cu5

View 3cu5 on RCSB PDB site
Description: Crystal structure of a two component transcriptional regulator AraC from Clostridium phytofermentans ISDg
Class: transcription regulator
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, transcriptional regulator, AraC, TRANSCRIPTION REGULATOR, PSI-2
Deposited on 2008-04-15, released 2008-05-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.189
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Two component transcriptional regulator, AraC family
    Species: Clostridium phytofermentans [TaxId:357809]
    Gene: Cphy_0579
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9KIW7 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.03: d3cu5a_
  • Chain 'B':
    Compound: Two component transcriptional regulator, AraC family
    Species: Clostridium phytofermentans [TaxId:357809]
    Gene: Cphy_0579
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9KIW7 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.03: d3cu5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cu5A (A:)
    mslrilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmp
    rmdgielvdnilklypdcsvifmsgysdkeylkaaikfrairyvekpidpseimdalkqs
    iqtvlqhqaqqdseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cu5A (A:)
    slrilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmpr
    mdgielvdnilklypdcsvifmsgysdkeylrairyvekpidpseimdalkqsiqtvlqh
    qaqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cu5B (B:)
    mslrilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmp
    rmdgielvdnilklypdcsvifmsgysdkeylkaaikfrairyvekpidpseimdalkqs
    iqtvlqhqaqqdseghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cu5B (B:)
    slrilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmpr
    mdgielvdnilklypdcsvifmsgysdkeylkaaikfrairyvekpidpseimdalkqsi
    qtvlqhqaq