PDB entry 3cu4

View 3cu4 on RCSB PDB site
Description: OmcF, Outer membrance cytochrome F from Geobacter sulfurreducens
Class: electron transport
Keywords: cytochrome c6, Geobacter sulfurreducens, monoheme cytochrome, ELECTRON TRANSPORT
Deposited on 2008-04-15, released 2008-10-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.169
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU2432
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3cu4a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cu4A (A:)
    sggsgagggelfathcagchpqggntvhpektlararreangirtvrdvaayirnpgpgm
    pafgeamippadalkigeyvvasfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cu4A (A:)
    gggelfathcagchpqggntvhpektlararreangirtvrdvaayirnpgpgmpafgea
    mippadalkigeyvvasfp