PDB entry 3cta

View 3cta on RCSB PDB site
Description: Crystal structure of riboflavin kinase from Thermoplasma acidophilum
Class: transferase
Keywords: STRUCTURAL GENOMICS, TRANSFERASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, FMN, Kinase, Magnesium, Metal-binding, Nucleotide-binding
Deposited on 2008-04-11, released 2008-04-29
The last revision prior to the SCOP 1.75 freeze date was dated 2008-07-15, with a file datestamp of 2008-07-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.237
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase
    Species: Thermoplasma acidophilum DSM 1728 [TaxId:273075]
    Gene: rfk, Ta1064
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3ctaa1, d3ctaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ctaA (A:)
    msletddqyyraikkikeaaeasnrayltsskladmlgisqqsasriiidlekngyitrt
    vtkrgqilnitekgldvlytefadlsrilaiknnvvitgtvtsgmgegryyvarkqyiiq
    fqeklgiipylgtlnikvdqaslpelrkirgfrgihiegfktedrtfgsvkafpakiqni
    pcfvimpertvytdvieiisdkylreeinlhdgdrvsvevyteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ctaA (A:)
    dqyyraikkikeaaeasnrayltsskladmlgisqqsasriiidlekngyitrtvtkrgq
    ilnitekgldvlytefadlsrilaiknnvvitgtvtsqyiiqfqeklgiipylnikvdqa
    slpelrkirgfrgihiegfktrtfgsvkafpakiqnipcfvimpertvytdvieiisddr
    vsvevyt