PDB entry 3ct2

View 3ct2 on RCSB PDB site
Description: Crystal structure of muconate cycloisomerase from Pseudomonas fluorescens
Class: isomerase
Keywords: Structural genomics, target 9450f, MLE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Isomerase
Deposited on 2008-04-11, released 2008-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Pseudomonas fluorescens [TaxId:220664]
    Gene: catB, PFL_3862
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K9X1 (3-373)
      • expression tag (374)
    Domains in SCOPe 2.06: d3ct2a1, d3ct2a2, d3ct2a3
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Pseudomonas fluorescens [TaxId:220664]
    Gene: catB, PFL_3862
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K9X1 (3-373)
      • expression tag (374)
    Domains in SCOPe 2.06: d3ct2b1, d3ct2b2, d3ct2b3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ct2A (A:)
    mslhasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttiggla
    ygnespdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgk
    rlglpvsellggrvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrd
    lahviaikkalgdsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrl
    nasspapimadesiecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagigly
    ggtmleggigtlasahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapgl
    glsldeerlaffrreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ct2A (A:)
    hasaiesietiivdlptinqtlvlirlrcadgieglgesttigglaygnespdsiktnid
    rfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlglpvsellggrv
    rdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlahviaikkalgds
    asvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnasspapimadesi
    ecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggtmleggigtlas
    ahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglglsldeerlaffrr
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ct2B (B:)
    mslhasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttiggla
    ygnespdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgk
    rlglpvsellggrvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrd
    lahviaikkalgdsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrl
    nasspapimadesiecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagigly
    ggtmleggigtlasahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapgl
    glsldeerlaffrreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ct2B (B:)
    hasaiesietiivdlptinqtlvlirlrcadgieglgesttigglaygnespdsiktnid
    rfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlglpvsellggrv
    rdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlahviaikkalgds
    asvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnasspapimadesi
    ecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggtmleggigtlas
    ahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglglsldeerlaffrr
    e