PDB entry 3csw

View 3csw on RCSB PDB site
Description: Crystal structure of a putative branched-chain amino acid aminotransferase (TM0831) from Thermotoga maritima at 2.15 A resolution
Class: transferase
Keywords: TM0831, Putative Branched-Chain Amino Acid Aminotransferase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Amino-acid biosynthesis, Branched-chain amino acid biosynthesis, Pyridoxal phosphate, TRANSFERASE
Deposited on 2008-04-10, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM0831, ilvE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74921 (13-284)
      • leader sequence (11)
      • see remark 999 (12)
    Domains in SCOPe 2.07: d3cswa1, d3cswa2
  • Chain 'B':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM0831, ilvE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74921 (13-284)
      • leader sequence (11)
      • see remark 999 (12)
    Domains in SCOPe 2.07: d3cswb1, d3cswb2
  • Chain 'C':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM0831, ilvE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74921 (13-284)
      • leader sequence (10-11)
      • see remark 999 (12)
    Domains in SCOPe 2.07: d3cswc1, d3cswc2
  • Chain 'D':
    Compound: Putative branched-chain-amino-acid aminotransferase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: TM0831, ilvE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74921 (13-284)
      • leader sequence (11)
      • see remark 999 (12)
    Domains in SCOPe 2.07: d3cswd1, d3cswd2
  • Heterogens: PLP, UNL, CIT, MPD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cswA (A:)
    mgsdkihhhhhhvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhy
    trlkrsadffnlplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipd
    letgvevkisnvrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfs
    nvflvkegklitpsldsgildgitrenviklaksleipveervvwvwelfeademfltht
    sagvvpvrrlnehsffeeepgpvtatlmenfepfvlnleenwvgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cswA (A:)
    hvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffn
    lplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisn
    vrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegkli
    tpsldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrln
    ehsffeeepgpvtatlmenfepfvlnleenwvgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cswB (B:)
    mgsdkihhhhhhvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhy
    trlkrsadffnlplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipd
    letgvevkisnvrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfs
    nvflvkegklitpsldsgildgitrenviklaksleipveervvwvwelfeademfltht
    sagvvpvrrlnehsffeeepgpvtatlmenfepfvlnleenwvgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cswB (B:)
    hvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffn
    lplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisn
    vrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegkli
    tpsldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrln
    ehsffeeepgpvtatlmenfepfvlnleenwvgi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cswC (C:)
    mgsdkihhhhhhvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhy
    trlkrsadffnlplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipd
    letgvevkisnvrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfs
    nvflvkegklitpsldsgildgitrenviklaksleipveervvwvwelfeademfltht
    sagvvpvrrlnehsffeeepgpvtatlmenfepfvlnleenwvgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cswC (C:)
    hhvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadff
    nlplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkis
    nvrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegkl
    itpsldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrl
    nehsffeeepgpvtatlmenfepfvlnleenwvgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cswD (D:)
    mgsdkihhhhhhvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhy
    trlkrsadffnlplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipd
    letgvevkisnvrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfs
    nvflvkegklitpsldsgildgitrenviklaksleipveervvwvwelfeademfltht
    sagvvpvrrlnehsffeeepgpvtatlmenfepfvlnleenwvgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cswD (D:)
    hvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffn
    lplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisn
    vrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegkli
    tpsldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrln
    ehsffeeepgpvtatlmenfepfvlnleenwvgi