PDB entry 3cs8

View 3cs8 on RCSB PDB site
Description: Structural and Biochemical Basis for the Binding Selectivity of PPARg to PGC-1a
Class: nuclear protein
Keywords: coactivator, nuclear receptor, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Polymorphism, Transcription, Transcription regulation, Zinc, Zinc-finger, RNA-binding, NUCLEAR PROTEIN
Deposited on 2008-04-09, released 2008-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: HOMO SAPIENS
    Gene: PPARGC1A, LEM6, PGC1, PGC1A, PPARGC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (4-274)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d3cs8a2, d3cs8a3
  • Chain 'B':
    Compound: PGC-1alfa peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, BRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cs8A (A:)
    rggspesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
    vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
    sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
    lrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cs8A (A:)
    rggspesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
    iplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiy
    tmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaif
    iaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivt
    ehvqllqvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    No sequence available.