PDB entry 3crn

View 3crn on RCSB PDB site
Description: Crystal structure of response regulator receiver domain protein (CheY-like) from Methanospirillum hungatei JF-1
Class: signaling protein
Keywords: STRUCTURAL GENOMICS, SIGNAL REGULATOR RECEIVER DOMAIN, PROTEIN STRUCTURE INITIATIVE, PSI-2, New York SGX Research Center for Structural Genomics, NYSGXRC, SIGNALING PROTEIN
Deposited on 2008-04-07, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver domain protein, CheY-like
    Species: Methanospirillum hungatei [TaxId:323259]
    Gene: REC, Mhun_3201
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2FNF5 (3-123)
      • expression tag (2)
      • expression tag (124-130)
    Domains in SCOPe 2.07: d3crna1, d3crna2, d3crna3
  • Chain 'B':
    Compound: Response regulator receiver domain protein, CheY-like
    Species: Methanospirillum hungatei [TaxId:323259]
    Gene: REC, Mhun_3201
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2FNF5 (3-123)
      • expression tag (1-2)
      • expression tag (124-125)
    Domains in SCOPe 2.07: d3crnb1, d3crnb2, d3crnb3
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3crnA (A:)
    mslkrilivdddtaildstkqilefegyeveiaatageglakieneffnlalfdiklpdm
    egtellekahklrpgmkkimvtgyaslensvfslnagadayimkpvnprdllekikekld
    eqekeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3crnA (A:)
    lkrilivdddtaildstkqilefegyeveiaatageglakieneffnlalfdiklpdmeg
    tellekahklrpgmkkimvtgyaslensvfslnagadayimkpvnprdllekikekldeq
    ekeghhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3crnB (B:)
    mslkrilivdddtaildstkqilefegyeveiaatageglakieneffnlalfdiklpdm
    egtellekahklrpgmkkimvtgyaslensvfslnagadayimkpvnprdllekikekld
    eqekeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3crnB (B:)
    slkrilivdddtaildstkqilefegyeveiaatageglakieneffnlalfdiklpdme
    gtellekahklrpgmkkimvtgyaslensvfslnagadayimkpvnprdllekikeklde
    qekeg