PDB entry 3cql

View 3cql on RCSB PDB site
Description: Crystal Structure of GH family 19 chitinase from Carica papaya
Class: hydrolase
Keywords: GLYCOSYL HYDROLASE, CHITINASE, N-ACETYL-D-GLUCOSAMINE, Carbohydrate metabolism, Chitin degradation, Chitin-binding, Glycosidase, Hydrolase, Polysaccharide degradation, Vacuole
Deposited on 2008-04-03, released 2008-08-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.162
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endochitinase
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P85084 (0-242)
      • see remark 999 (34)
      • see remark 999 (56)
      • see remark 999 (116)
      • see remark 999 (148)
      • see remark 999 (171)
      • see remark 999 (193)
      • see remark 999 (196-197)
      • see remark 999 (215)
      • see remark 999 (224)
    Domains in SCOPe 2.05: d3cqla_
  • Chain 'B':
    Compound: Endochitinase
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P85084 (0-242)
      • see remark 999 (34)
      • see remark 999 (56)
      • see remark 999 (116)
      • see remark 999 (148)
      • see remark 999 (171)
      • see remark 999 (193)
      • see remark 999 (196-197)
      • see remark 999 (215)
      • see remark 999 (224)
    Domains in SCOPe 2.05: d3cqlb_
  • Heterogens: NDG, NAG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cqlA (A:)
    giekiisrsmfdqmlkhrnnpacpakgfytydafiaaaksfpsfgttgstdvrkreiaaf
    lgqtshettggwpsapdgpyawgycflkernpssnycapsprypcapgksyygrgpiqls
    wnynygpcgealrvnllgnpdlvatdrvisfktalwfwmtpqapkpschdvitgrwqpsa
    adtaagrlpgygvitniingglecgkgpnpqvadrigffrrycgilgvgtgnnldcynqr
    pfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cqlB (B:)
    giekiisrsmfdqmlkhrnnpacpakgfytydafiaaaksfpsfgttgstdvrkreiaaf
    lgqtshettggwpsapdgpyawgycflkernpssnycapsprypcapgksyygrgpiqls
    wnynygpcgealrvnllgnpdlvatdrvisfktalwfwmtpqapkpschdvitgrwqpsa
    adtaagrlpgygvitniingglecgkgpnpqvadrigffrrycgilgvgtgnnldcynqr
    pfg