PDB entry 3con

View 3con on RCSB PDB site
Description: Crystal structure of the human NRAS GTPase bound with GDP
Class: hydrolase
Keywords: Structural Genomics Consortium, SGC, gtpase, gdp, oncogene, Disease mutation, Golgi apparatus, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Palmitate, Prenylation, Proto-oncogene, HYDROLASE
Deposited on 2008-03-28, released 2008-04-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase NRas
    Species: Homo sapiens [TaxId:9606]
    Gene: NRAS, HRAS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3cona_
  • Heterogens: MG, GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3conA (A:)
    mhhhhhhssgrenlyfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrk
    qvvidgetclldildtagqeeysamrdqymrtgegflcvfainnsksfadinlyreqikr
    vkdsddvpmvlvgnkcdlptrtvdtkqahelaksygipfietsaktrqgvedafytlvre
    irqyrmkkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3conA (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    mrtgegflcvfainnsksfadinlyreqikrvkdsddvpmvlvgnkcdlptrtvdtkqah
    elaksygipfietsaktrqgvedafytlvreirqyr