PDB entry 3coh

View 3coh on RCSB PDB site
Description: Crystal structure of Aurora-A in complex with a pentacyclic inhibitor
Class: transferase
Keywords: Aurora-A, Inhibitor Complex, ATP-binding, Cell cycle, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2008-03-28, released 2009-02-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered (30)
      • engineered (79)
      • engineered (127)
      • engineered (212)
    Domains in SCOPe 2.04: d3coha_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, ARK1, AURA, BTAK, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered (30)
      • engineered (79)
      • engineered (127)
      • engineered (212)
    Domains in SCOPe 2.04: d3cohb_
  • Heterogens: 83H

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cohA (A:)
    akrqwaledfeigrplgkgkfgnvylareknskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdstrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskkvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqdtykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cohA (A:)
    waledfeigrplgkgkfgnvylareknskfilalkvlfkaqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdstrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
    hskkvihrdikpenlllgsagelkiadlcgtldylppemiegrmhdekvdlwslgvlcye
    flvgkppfeantyqdtykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehp
    witanss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cohB (B:)
    akrqwaledfeigrplgkgkfgnvylareknskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdstrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskkvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqdtykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cohB (B:)
    waledfeigrplgkgkfgnvylareknskfilalkvlfkaqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdstrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
    hskkvihrdikpenlllgsagelkiadlcgtldylppemiegrmhdekvdlwslgvlcye
    flvgkppfeantyqdtykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehp
    witanss