PDB entry 3cnn

View 3cnn on RCSB PDB site
Description: GTP-bound structure of TM YlqF
Class: signaling protein
Keywords: YlqF, circular permutation, GTP, SIGNALING PROTEIN
Deposited on 2008-03-26, released 2008-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0768
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cnna_
  • Heterogens: GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cnnA (A:)
    mswypghiekakrqikdllrlvntvvevrdarapfatsaygvdfsrketiillnkvdiad
    ekttkkwveffkkqgkrvitthkgeprkvllkklsfdrlarvlivgvpntgkstiinklk
    gkrassvgaqpgitkgiqwfslengvkildtpgilyknifsedlaaklllvgslpverie
    dqriferafeifarsigiessfseffedfarkrgllkkggvpdieralmlfftevaqgka
    grvsferpeditpvqqeqtrgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cnnA (A:)
    rqikdllrlvntvvevrdarapfatsaygvdfsrketiillnkvdiadekttkkwveffk
    kqgkrvitthkgeprkvllkklsfdrlarvlivgvpntgkstiinklkgkragiqwfsle
    ngvkildtpgilyknifsedlaaklllvgslpveriedqriferafeifarsigiessfs
    effedfarkrgllkkggvpdieralmlfftevaqgkagrvsferped