PDB entry 3cmz

View 3cmz on RCSB PDB site
Description: TEM-1 Class-A beta-lactamase L201P mutant apo structure
Class: hydrolase
Keywords: stabilization mutation, Antibiotic resistance, Hydrolase, Plasmid, Transposable element
Deposited on 2008-03-24, released 2008-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: ESCHERICHIA COLI
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered (175)
    Domains in SCOPe 2.05: d3cmza_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cmzA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltpasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw