PDB entry 3cmn

View 3cmn on RCSB PDB site
Description: Crystal structure of a putative hydrolase with a novel fold from Chloroflexus aurantiacus
Class: hydrolase
Keywords: PSI-II, NYSGXRC, Putative hydrolase, apoenzyme, helical protein, 10492m, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, HYDROLASE
Deposited on 2008-03-24, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hydrolase
    Species: Chloroflexus aurantiacus [TaxId:324602]
    Gene: Caur_0242
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9WCA2 (Start-363)
      • expression tag (364-365)
    Domains in SCOPe 2.08: d3cmna1, d3cmna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cmnA (A:)
    msletrarnstrpasglidweqarqaalrlsqweqapvdnrafrreqyarmvalseplia
    dylgvrlpepvsrifvfdrrewleanivsfsqlfrpieemyekngggrgalgvlmndvss
    kllgvqiggllgylaqrvlgqydlsllsaeatggslyfvepniarvqqqlglsdedfrlw
    itlhemthafefeaypwvrtyfrelleqnfalvsgqmlssgnslvdmlmrllqgigsgqh
    wietvltpeqravfdriqalmsliegygnhvmnavgrrllpsfnqieqqiaqrqrqrtml
    dqmvfrltgldlklaqyqqgeafvnavvaargiqfasrvwerpenlpsmdeirnpgqwiv
    rmdreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cmnA (A:)
    lidweqarqaalrlsqweqapvdnrafrreqyarmvalsepliadylgvrlpepvsrifv
    fdrrewleanivsfsqlfrpieemyeksskllgvqiggllgylaqrvlgqydlsllsagg
    slyfvepniarvqqqlglsdedfrlwitlhemthafefeaypwvrtyfrelleqnfaltp
    eqravfdriqalmsliegygnhvmnavgrrllpsfnqieqqiaqrqrqrtmldqmvfrlt
    gldlklaqyqqgeafvnavvaargiqfasrvwerpenlpsmdeirnpgqwivrmdreg