PDB entry 3cln

View 3cln on RCSB PDB site
Description: structure of calmodulin refined at 2.2 angstroms resolution
Class: calcium binding protein
Keywords: calcium binding protein
Deposited on 1988-05-11, released 1988-07-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3clna_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3clnA (A:)
    adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee
    vdemireanidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3clnA (A:)
    teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid
    fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem
    ireanidgdgqvnyeefvqmmta