PDB entry 3cle

View 3cle on RCSB PDB site
Description: HIV neutralizing monoclonal antibody YZ23
Class: immune system
Keywords: HIV-1, monoclonal antibody, Immune System
Deposited on 2008-03-18, released 2008-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CLE (0-End)
    Domains in SCOPe 2.07: d3cleh1
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CLE (0-End)
    Domains in SCOPe 2.07: d3clel1, d3clel2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cleH (H:)
    qaqlqesgaelvrpgasvkmsckasgyrftsynmhwvkqtprqglewigaiypgngdtsy
    nqkfkgkatltvdkssstaymqlssltsedsavyfcargrlslgfdywgqgstltvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cleH (H:)
    qaqlqesgaelvrpgasvkmsckasgyrftsynmhwvkqtprqglewigaiypgngdtsy
    nqkfkgkatltvdkssstaymqlssltsedsavyfcargrlslgfdywgqgstltvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3cleL (L:)
    divmtqsqkfmstsvgdrvsisckasqnvgniiawyqqkpgqspkaliylasyrysgvpd
    rftgsgsgtdftltisnvqsedlaeyfcqqyssfpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cleL (L:)
    divmtqsqkfmstsvgdrvsisckasqnvgniiawyqqkpgqspkaliylasyrysgvpd
    rftgsgsgtdftltisnvqsedlaeyfcqqyssfpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn