PDB entry 3cjw

View 3cjw on RCSB PDB site
Description: Crystal structure of the human COUP-TFII ligand binding domain
Class: transcription
Keywords: COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger
Deposited on 2008-03-14, released 2008-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.168
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COUP transcription factor 2
    Species: HOMO SAPIENS
    Gene: NR2F2, ARP1, TFCOUP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24468 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3cjwa1, d3cjwa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cjwA (A:)
    gsnshsylsgyislllraepyptsrfgsqcmqpnnimgienicelaarmlfsavewarni
    pffpdlqitdqvallrltwselfvlnaaqcsmplhvapllaaaglhaspmsadrvvafmd
    hirifqeqveklkalhvdsaeysclkaivlftsdacglsdvahveslqeksqcaleeyvr
    sqypnqptrfgklllrlpslrtvsssvieqlffvrlvgktpietlirdmllsgssfnwpy
    maiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjwA (A:)
    gsnshsylsgyislllraepyptmgienicelaarmlfsavewarnipffpdlqitdqva
    llrltwselfvlnaaqcsmplhvapvafmdhirifqeqveklkalhvdsaeysclkaivl
    ftsdacglsdvahveslqeksqcaleeyvrsqypnqptrfgklllrlpslrtvsssvieq
    lffvrlvgktpietlirdmllsgssfn