PDB entry 3cjn

View 3cjn on RCSB PDB site
Description: Crystal structure of transcriptional regulator, MarR family, from Silicibacter pomeroyi
Class: transcription regulator
Keywords: Transcriptional regulator, MarR family, Silicibacter pomeroyi, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, DNA-binding, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2008-03-13, released 2008-03-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.181
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, MarR family
    Species: Silicibacter pomeroyi DSS-3 [TaxId:246200]
    Gene: SPO1458
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cjna_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cjnA (A:)
    snamaestdqteqlrelaeiglegyapylmnrimgrynanlrkemtalglstakmralai
    lsakdglpigtlgifavveqstlsraldglqadglvrrevdsddqrssrvyltpagravy
    drlwphmrashdrmfqgitpqerqaflatlnkmlanirvhei
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjnA (A:)
    relaeiglegyapylmnrimgrynanlrkemtalglstakmralailsakdglpigtlgi
    favveqstlsraldglqadglvrrevddqrssrvyltpagravydrlwphmrashdrmfq
    gitpqerqaflatlnkmlanirvhei