PDB entry 3cji

View 3cji on RCSB PDB site
Description: Structure of Seneca Valley Virus-001
Class: virus
Keywords: virus capsid protein structure, ATP-binding, Cytoplasm, Cytoplasmic vesicle, Helicase, Hydrolase, Membrane, Nucleotide-binding, Nucleotidyltransferase, Phosphoprotein, Protease, RNA replication, RNA-binding, RNA-directed RNA polymerase, Thiol protease, Transferase, Virion, icosahedral virus, virus
Deposited on 2008-03-13, released 2008-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-16, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.258
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cjia_
  • Chain 'B':
    Compound: Polyprotein
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cjib_
  • Chain 'C':
    Compound: Polyprotein
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Polyprotein
    Species: Seneca valley virus [TaxId:390157]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cjiA (A:)
    stdnaetgvieagntdtdfsgelaapgsnhtnvkflfdrsrllnvikvlekdavfprpfp
    tqegaqqddgyfclltprptvasrpatrfglyanpsgsgvlantsldfnfyslacftyfr
    sdlevtvvslepdlefavgwfpsgseyqassfvydqlhvpfhftgrtprafaskggkvsf
    vlpwnsvssvlpvrwggasklssatrglpahadwgtiyafvprpnekkstavkhvavyir
    yknarawcpsmlpfrsykqkmlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjiA (A:)
    stdnaetgvieagntdtdfsgelaapgsnhtnvkflfdrsrllnvikvlekdavfprpfp
    tqegaqqddgyfclltprptvasrpatrfglyanpsgsgvlantsldfnfyslacftyfr
    sdlevtvvslepdlefavgwfpsgseyqassfvydqlhvpfhftgrtprafaskggkvsf
    vlpwnsvssvlpvrwggasklssatrglpahadwgtiyafvprpnekkstavkhvavyir
    yknarawcpsmlpfrsyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cjiB (B:)
    gpiptaprenslmflstlpddtvpaygnvrtppvnylpgeitdllqlariptlmafervp
    epvpasdtyvpyvavptqfddrplisfpitlsdpvyqntlvgaissnfanyrgciqitlt
    fcgpmmargkfllsysppngtqpqtlseamqctysiwdiglnsswtfvvpyispsdyret
    raitnsvysadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cjiB (B:)
    gpiptaprenslmflstlpddtvpaygnvrtppvnylpgeitdllqlariptlmafervp
    epvpasdtyvpyvavptqfddrplisfpitlsdpvyqntlvgaissnfanyrgciqitlt
    fcgpmmargkfllsysppngtqpqtlseamqctysiwdiglnsswtfvvpyispsdyret
    raitnsvysadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.