PDB entry 3cgo

View 3cgo on RCSB PDB site
Description: IRAK-4 Inhibitors (Part II)- A structure based assessment of imidazo[1,2 a]pyridine binding
Class: transferase
Keywords: JNK3 kinase, Inhibitor, Alternative splicing, ATP-binding, Chromosomal rearrangement, Cytoplasm, Epilepsy, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2008-03-06, released 2008-06-03
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-10, with a file datestamp of 2008-06-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.243
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: HOMO SAPIENS
    Gene: MAPK10, JNK3, JNK3A, PRKM10
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cgoa1
  • Heterogens: JNO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cgoA (A:)
    mgskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsr
    pfqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqvi
    qmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagts
    fmmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvie
    qlgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardlls
    kmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliyke
    vmnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cgoA (A:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglasfmmtpyvvtryy
    rapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkk
    lqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakris
    vddalqhpyinvwyrehtieewkeliykevmn