PDB entry 3cg4

View 3cg4 on RCSB PDB site
Description: Crystal structure of response regulator receiver domain protein (CheY-like) from Methanospirillum hungatei JF-1
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, UNCHARACTERIZED PROTEIN, SIGNAL REGULATOR RECEIVER DOMAIN, PROTEIN STRUCTURE INITIATIVE, PSI-2, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2008-03-04, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver domain protein (CheY-like)
    Species: Methanospirillum hungatei [TaxId:323259]
    Gene: REC, Mhun_0886
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cg4a_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cg4A (A:)
    mslaehkgdvmivdddahvriavktilsdagfhiisadsggqcidllkkgfsgvvlldim
    mpgmdgwdtiraildnsleqgiaivmltaknapdakmiglqeyvvdyitkpfdnedliek
    ttffmgfvrnqtgneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cg4A (A:)
    hkgdvmivdddahvriavktilsdagfhiisadsggqcidllkkgfsgvvlldimmpgmd
    gwdtiraildnsleqgiaivmltaknapdakmiglqeyvvdyitkpfdnedliekttffm
    gfvrnq